Product Information
LL-37
5mg • ≥99% Purity
Product Overview
LL-37 is a naturally occurring human antimicrobial peptide consisting of 37 amino acids. It is derived from the human cathelicidin precursor protein hCAP18. LL-37 is supplied as a high purity lyophilized powder for laboratory research.
Technical Specifications
Common Name: LL-37
Chemical Name: Human Cathelicidin LL-37
Peptide Classification: Cathelicidin Antimicrobial Peptide
Amino Acid Sequence: [LL-37, 37 aa]
Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight: Approximately 4493.3 g/mol
CAS Registry Number: 154947-66-7
Appearance: Lyophilized powder
Purity: ≥99%
Product Identification
LL-37 may also be referenced in scientific literature plus laboratory databases under the following names:
- LL-37
- Cathelicidin LL-37
- Human Cathelicidin LL-37
- hCAP18 derived antimicrobial peptide
- CAP-18 derived antimicrobial peptide
Research Library
Expand your understanding of peptide science through the LasVegasDiet.com Research Library, featuring objective information on peptide terminology, classifications, molecular structures, laboratory standards, plus scientific history. This follows the wording used on your existing product pages.
Topics Include:
- Peptide Terminology
- Antimicrobial Peptides
- Cathelicidins
- Molecular Structures
- Lyophilization
- Purity Standards
- CAS Registry Numbers
Button: