Product Information
Cagrilintide
5mg • ≥99% Purity
Product Overview
Cagrilintide is a synthetic, long acting analogue of the peptide hormone amylin. It consists of a modified 37 amino acid peptide sequence plus structural modifications designed to extend its activity. It is supplied as a high purity lyophilized powder for laboratory research.
Technical Specifications
Common Name: Cagrilintide
Chemical Name: Cagrilintide
Peptide Classification: Long Acting Amylin Analogue
Amino Acid Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
Molecular Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂
Molecular Weight: 4409 g/mol
CAS Registry Number: 1415456-99-3
Appearance: Lyophilized powder
Purity: ≥99%
Product Identification
Cagrilintide may also be referenced in scientific literature plus laboratory databases under the following names:
- Cagrilintide
- Cagrilintide [INN]
- AM833
Research Library
Expand your understanding of peptide science through the LasVegasDiet.com Research Library, featuring objective information on peptide terminology, classifications, molecular structures, laboratory standards, plus scientific history. This follows the wording already used on your existing product pages.
Topics Include:
- Peptide Terminology
- Amylin Analogues
- Molecular Structures
- Lyophilization
- Purity Standards
- CAS Registry Numbers
The molecular formula, molecular weight, CAS number, plus sequence above are verified against the current PubChem record.
Button: